PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008233055.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 400aa    MW: 45211.1 Da    PI: 6.1897
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008233055.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.64.2e-52161441128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eel+++yLkkkv++++++l +vi++vd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk +
  XP_008233055.1  16 VPPGFRFHPTEEELLQYYLKKKVSNQSIDL-DVIRDVDLNKLEPWDIQEKCKIgttPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVI 109
                     69****************************.9***************964444222455**********************************99 PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      s + + +g++ktLvfykgrap+g+k+dW+mheyrl
  XP_008233055.1 110 SS-NCRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 144
                     99.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.03E-5810177IPR003441NAC domain
PROSITE profilePS5100556.66816177IPR003441NAC domain
PfamPF023653.2E-2817144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MAPENMSISV NGQSQVPPGF RFHPTEEELL QYYLKKKVSN QSIDLDVIRD VDLNKLEPWD  60
IQEKCKIGTT PQNDWYFFSH KDKKYPTGTR TNRATAAGFW KATGRDKVIS SNCRRIGMRK  120
TLVFYKGRAP HGQKSDWIMH EYRLDDNNTS NCITNVPMIV GEAAQEEGWV VCRIFKKKNL  180
HKIGSGSTIM STTTSSMTTE TRSAQSLFDS CPEGALEQML QYIGRTCKEE ENEGNNMSTR  240
FNLQPINTGV NNHNGYHERF LKLPSLDSPN STSSQDCYQP NIHEEVMAAE NNIDEDFQHQ  300
MDSGLTNWAA LDRFVASQLN GQAETSRQLA CFSDPYDCND DHHELQLPTT LRSISSSSSN  360
KSYHATQDYN NGEINLWSFA RQSSSLSSSD ALCHVSNGPI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-501317914167NO APICAL MERISTEM PROTEIN
1ut4_B2e-501317914167NO APICAL MERISTEM PROTEIN
1ut7_A2e-501317914167NO APICAL MERISTEM PROTEIN
1ut7_B2e-501317914167NO APICAL MERISTEM PROTEIN
3swm_A2e-501317917170NAC domain-containing protein 19
3swm_B2e-501317917170NAC domain-containing protein 19
3swm_C2e-501317917170NAC domain-containing protein 19
3swm_D2e-501317917170NAC domain-containing protein 19
3swp_A2e-501317917170NAC domain-containing protein 19
3swp_B2e-501317917170NAC domain-containing protein 19
3swp_C2e-501317917170NAC domain-containing protein 19
3swp_D2e-501317917170NAC domain-containing protein 19
4dul_A2e-501317914167NAC domain-containing protein 19
4dul_B2e-501317914167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008233055.10.0PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP61e-141NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM5X7Y10.0M5X7Y1_PRUPE; Uncharacterized protein
STRINGVIT_15s0048g02660.t011e-172(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-128NAC family protein